General Information

  • ID:  hor006108
  • Uniprot ID:  P05125
  • Protein name:  Atriopeptin-1
  • Gene name:  Nppa
  • Organism:  Mus musculus (Mouse)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0051427 hormone receptor binding; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006182 cGMP biosynthetic process; GO:0006457 protein folding; GO:0006950 response to stress; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007565 female pregnancy; GO:0008217 regulation of blood pressure; GO:0010460 positive regulation of heart rate; GO:0010753 positive regulation of cGMP-mediated signaling; GO:0014898 cardiac muscle hypertrophy in response to stress; GO:0019934 cGMP-mediated signaling; GO:0030308 negative regulation of cell growth; GO:0036376 sodium ion export across plasma membrane; GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway; GO:0042311 vasodilation; GO:0045776 negative regulation of blood pressure; GO:0060372 regulation of atrial cardiac muscle cell membrane repolarization; GO:0060452 positive regulation of cardiac muscle contraction; GO:0090090 negative regulation of canonical Wnt signaling pathway; GO:0097746 blood vessel diameter maintenance; GO:0099538 synaptic signaling via neuropeptide; GO:1902514 regulation of calcium ion transmembrane transport via high voltage-gated calcium channel; GO:1903595 positive regulation of histamine secretion by mast cell; GO:1903766 positive regulation of potassium ion export across plasma membrane; GO:1903815 negative regulation of collecting lymphatic vessel constriction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005903 brush border; GO:0032991 protein-containing complex; GO:0042629 mast cell granule; GO:0042995 cell projection; GO:0043204 perikaryon; GO:0048471 perinuclear region of cytoplasm; GO:0098690 glycinergic synapse

Sequence Information

  • Sequence:  SSCFGGRIDRIGAQSGLGCNSFR
  • Length:  23
  • Propeptide:  MGSFSITLGFFLVLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKMPVEDEVMPPQALSEQTEEAGAALSSLPEVPPWTGEVNPPLRDGSALGRSPWDPSDRSALLKSKLRALLAGPRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR
  • Signal peptide:  MGSFSITLGFFLVLAFWLPGHIGA
  • Modification:  T2 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Atrial natriuretic peptide]: Hormone that plays a key role in mediating cardio-renal homeostasis, and is involved in vascular remodeling and regulating energy metabolism (PubMed:8760210, PubMed:22437503, PubMed:12890708). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins, such as PRKG1, that drive various biological responses (PubMed:12890708). Regulates vasodilation, natriuresis, diuresis and aldosterone synthesis and is therefore essential for regulating blood pressure, controlling the extracellular fluid volume and maintaining the fluid-electrolyte balance (PubMed:8760210, PubMed:22437503). Also involved in inhibiting cardiac remodeling and cardiac hypertrophy by inducing cardiomyocyte apoptosis and attenuating the growth of cardiomyocytes and fibroblasts (By similarity). Plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus, and thus prevents pregnancy-induced hypertension (PubMed:22437503). In adipose tissue, acts in various cGMP- and PKG-dependent pathways to regulate lipid metabolism and energy homeostasis (By similarity). This includes up-regulating lipid metabolism and mitochondrial oxygen utilization by activating the AMP-activated protein kinase (AMPK), and increasing energy expenditure by acting via MAPK11 to promote the UCP1-dependent thermogenesis of brown adipose tissue (By similarity). Binds the clearance receptor NPR3 which removes the hormone from circulation (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npr1, Npr3
  • Target Unid:  P18293, P70180
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  3-19
  • Structure ID:  AF-P05125-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006108_AF2.pdbhor006108_ESM.pdb

Physical Information

Mass: 278125 Formula: C98H158N34O32S2
Absent amino acids: EHKMPTVWY Common amino acids: G
pI: 8.83 Basic residues: 3
Polar residues: 12 Hydrophobic residues: 6
Hydrophobicity: -17.39 Boman Index: -4947
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.22
Instability Index: 4922.17 Extinction Coefficient cystines: 125
Absorbance 280nm: 5.68

Literature

  • PubMed ID:  6542248
  • Title:  Nucleotide sequences of the human and mouse atrial natriuretic factor genes.
  • PubMed ID:  16141072
  • Title:  The transcriptional landscape of the mammalian genome.
  • PubMed ID:  19468303
  • Title:  Lineage-specific biology revealed by a finished genome assembly of the mouse.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  8760210
  • Title:  Blood pressure and fluid-electrolyte balance in mice with reduced or absent ANP.
  • PubMed ID:  11884416
  • Title:  Processing of pro-atrial natriuretic peptide by corin in cardiac myocytes.
  • PubMed ID:  12890708
  • Title:  Vascular natriuretic peptide receptor-linked particulate guanylate cyclases are modulated by nitric oxide-cyclic GMP signalling.
  • PubMed ID:  15637153
  • Title:  Hypertension in mice lacking the proatrial natriuretic peptide convertase corin.
  • PubMed ID:  21183079
  • Title:  A tissue-specific atlas of mouse protein phosphorylation and expression.
  • PubMed ID:  22437503
  • Title:  Role of corin in trophoblast invasion and uterine spiral artery remodelling in pregnancy.